SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000232116|PACid:22646641 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000232116|PACid:22646641
Domain Number 1 Region: 112-242
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-29
Family B3 DNA binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000232116|PACid:22646641
Sequence length 587
Sequence
MPPPHGRSIDPKVWRACAGNSVQIPTLNSRVYYFPQGHLEQSSPSSAAPVLLSPLLLSKP
LILCRISDLRFLADPTTDEVFAKLLLVPIPNEFPSIEPPNGDKLDADGNGDLERQDDRVF
SFAKILTPSDAHNGGGFSVPKFCADTIFPPLNFQADPPIQALFLTDLHGVVWEFRHIYRG
TPRRHLLTTGWSKFVNHKMLVAGDSVVFMRNGRGEMFIGVRRAVRASASSDCARWSYHIG
GGATNSMRLKTEDQDCSGRKVXSAEAVAEVAEMAAEGKPFEVVYYPKAGWWDFVVKSEVV
EKALKVFWTAGMRVKLAMETEDSSRMTWFQGTLSMASVPDNGPWQGSPWRMLQVTWDEPE
ALHNAKRVSPWQVEFVGSTPSIHTTFCPTKRFRAPLSHGLLINAEEEFFFPMTGAANLAM
GPFSASLLNYNFPAGMQGARQDTFSVSNLSHLLSENSPQACTYNSFGNNEVPKLKRVCTE
LNIGSSQSDELSPDSQSSVASFGMELDGNRLQTKVGTSSFQLFGKIIHTNQSVEGGSDDV
GCTEDSGNKEYNVAEGGHNHLDLNFTELLDRIDIKCQKTSAVDSCTL
Download sequence
Identical sequences MDP0000232116|PACid:22646641 XP_008338805.1.92800 MDP0000232116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]