SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000232417|PACid:22660261 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000232417|PACid:22660261
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-48
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 2 Region: 762-837
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000054
Family PB1 domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000232417|PACid:22660261
Sequence length 895
Sequence
MRLSSAGFSPQSQEGEKKVLNSELWHACAGPLVSLPAVGTRVVYFPQGHSEQVAASTNKE
VDAHIPNHPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKDGYLPAGLGSPN
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHDNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRQQTVMPSSVL
SSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVYHTCISVGMRFRM
LFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEVEPLT
TFPMYPSPFQLRLKRPWTPGLPSFNGMRDDDLGMNSQLVWLQGNNGDRGMQSLNFPGMGV
TPWMQPRLDASMIGLQSDXYQAMAAAALQEMRAVDPSRPLPTSLLQFQQPQSLPNSNRSA
ALMQPQMVQESHSQQAFLQGVQENHRQSQPXXQTQSHLLQQQLQHQNSFSNQQQQQLVDH
QHIPSAVSSLTQFASASQSQSPSLQVVTTLCHQQSFSDSNGNPATSTVISPLHNLMGSFP
QDESSHLLNLPRTNQLISSDGWPSKRAAIDPLLSSGVSQCVLPRVEQFGPPHTTMSQNSI
SLPPFPGRECSLDQEGGTDPQSHLLFGVNIESSPLIMQSGMSNLRGVGSDCGSTTMHFPS
NYMSTAGSDFSINPAVTPSSCIHESGFLQSSENADNGDPLNRNFVKVYKSGSFGRSLDIT
KFSSYQELRNELAHMFGLEGELDDPVRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIK
ILSPQEVQQMGKRGLELLKSVPNQRLSNNSCDDYGSRQDSRNLSSGITSVGSLEY
Download sequence
Identical sequences MDP0000232417|PACid:22660261 XP_008371797.1.92800 MDP0000232417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]