SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000232736|PACid:22657363 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000232736|PACid:22657363
Domain Number 1 Region: 247-544
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.1e-36
Family FAD-linked reductases, N-terminal domain 0.00055
Further Details:      
 
Weak hits

Sequence:  MDP0000232736|PACid:22657363
Domain Number - Region: 92-102
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00785
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 206-246
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00878
Family SWIRM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000232736|PACid:22657363
Sequence length 636
Sequence
MTSNGPVHGSVYSRLAWRPAWVGCQPICWAGXNWLGARPIXXLGASLKSPRWNCSQRSXN
PRFHAITLHFSTTLVKRLCINVQPSSTASNLPPPPPPPPPQPERTAMDPPNEFPMIFPPS
LLSPSPFLSPQNIQSVNLIQTHRRFQTQSKTLAPPIFFPSRSQRNEDEADYCDRQGIHSR
GADPLSAGFPADSLTEEKLDFPVIRVIGGIEQHCYSLLESTYKYLVSHGXINFGIAPAIK
EKIPXEPSKPHVIVIGHGLAGLAAARQMMRFGFKVTALEGRNRAGGWVYTKKMEGGIREG
VAADLGGSVLTGTLGNPLGIVARQLGYVLHKVRDKCLPYSFDGKPVDPDMDMKVEAAFNH
LLDKANLISKLSLAFWDQDDPYDMGGDHCFLPGGNGRLVHALAENVPILYERIVNTVSYA
TVAGGPLLIALVAGEAAHKFETMPPTDAVTRVIQILKGXYEPQGIXVPEPIQTICTRWGS
DPFSLGAYSXVAVGASGDDYDILAESVGDGRLFFAGEATNRRYPATMHDAFXSGLREAAN
MAHYANAGALRIKINRNPSKNAHSCASLLADLFREPDLEFGSFYVIALIKAERGNRKPAS
TSLTLKSGTSKLKADNLKQKLVRRAKIMRNGNGKLG
Download sequence
Identical sequences MDP0000232736|PACid:22657363 MDP0000232736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]