SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000233293|PACid:22671029 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000233293|PACid:22671029
Domain Number 1 Region: 150-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000255
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000233293|PACid:22671029
Sequence length 496
Sequence
MATKITLDYVRKLQVESFTKMLAEVKAVAKNRDEELSMLEQKVLLDLFQNKGKKSTESKK
RKAASASNNQKIKKHNFGSSSRSMQDEYVYYKDCDEEDHEKKARTKKQKXAKKAESVKLS
SPSIPLPPPELPKEFKEKIESMHGFQVQLMIQKQLFKTDLSYGHDRLSMPRNQVVNKHFL
GEHEKRLENGRVLEVKVIDSGLKERKLWLAKWFTHTQSSFSYVLGRGWRTILKDEEVGLN
ENDVIQVWSFRYIDPNPDIKKEGLGFALVKIRGDXKKDFNXXTSIERQQVIESAITKKDV
NGSTSTDRQEAXVSQXIKXDEMETDANVSTGTEXXEPVDLAMIKKEEXKKDSICSTASEE
AIESSKAKNKSLQAAVKAMKHVSLNLNTCMAIYSIDSWLLPKAVRSYMPRDQVINKNFLG
QDDERLNNGVIYVRVVDPCLMVHDDLGLTNTTDMQEAAESSMMKKDEEGKKDTNGCSSSR
GASASEEVIESSTTKK
Download sequence
Identical sequences MDP0000233293 MDP0000233293|PACid:22671029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]