SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000233653|PACid:22674667 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000233653|PACid:22674667
Domain Number 1 Region: 273-342
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000445
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000233653|PACid:22674667
Sequence length 805
Sequence
MNAAGWRCCESCGKRVHCGCIVSSHAFTLLDPGGIECMTCARKNYVMTSNPAWPTSMFFH
SPLSERLKDLSTKNWTQLAGSGPVPWRQAPSLFNSSIPSSELHXRVPHEVDGSTGINKLN
ASERIFVSTLEKKKVEEFSERLMKINLTIGTQQSLENGIGNPGNNIEEKSSSCLNISQQS
ASLKEEPSTPQFVPYGSASETNXQLGVTGTNLWPIAPLAKNYNGNSHNGVESSGDTQIRN
ARPRADARGRNQLLPRYWPRFTDQELQHISGEYPLRLPLKVQDSKGKEWIFQFRFWPNNN
SRMYVLEGVTPCIQSMQLLAGDIVTFSRLEPEGKLVMGFRKASTSLQSDQENEANKTTNG
VSAHAESAESPSFLSMNQVEVADPSSWSNVDKSGYIAKEALADKYYMPKKRKNSNLGSKS
KRLRIENEDLIELKVTWEEAQGLLRPPANHVPTVVVIEGFEFEEYEDAPLLGKPTIYATG
RAGERIQWAQCEDCFKWRKLPXNALLPSKWTCSENSWDPERSLCSAAQELTTEQLQDLLP
RCNTVASKKMKAAKQDPDNIEVLEGLDTLANLAILGEGESLPSSAQATTKHPRHRPGCSC
IVCIQPPSGKGPKHKQTCTCNVCLTVKRRFRTLMLRREKKQSDKEAETTRKKQHKGQLLV
VDKPEDDTLLYCNAGSSSPNQKIEILELSDDDLNLTKSSTSPFKGQIDLNIQPEREDELS
PGSDSGGMMKLLHDATARYLRQQRLSSSGGGEKSSGNGSPRAASEAGGGEPLSNGVNLES
SNHDGGNDCPATLSITASASMTATG
Download sequence
Identical sequences MDP0000233653 MDP0000233653|PACid:22674667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]