SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000235930|PACid:22635275 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000235930|PACid:22635275
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000122
Family FAD/NAD-linked reductases, N-terminal and central domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000235930|PACid:22635275
Sequence length 130
Sequence
MAAAQESSDAEMKRVVVIGGGVGGSVVAHSLQFCADVVLVDQKEYFEIPWGSLRAMVEPS
FAKRSIINHCDYLPNVRIVASTAANITDREVLTTDGRLLVYDYLVIATGHKDSVPKTRVA
RLSQYQAGNT
Download sequence
Identical sequences MDP0000235930 MDP0000235930|PACid:22635275 XP_017180174.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]