SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000236656|PACid:22666211 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000236656|PACid:22666211
Domain Number 1 Region: 116-204
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.65e-21
Family B3 DNA binding domain 0.0041
Further Details:      
 
Weak hits

Sequence:  MDP0000236656|PACid:22666211
Domain Number - Region: 29-87
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.0245
Family Adenylation domain of NAD+-dependent DNA ligase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000236656|PACid:22666211
Sequence length 205
Sequence
MARKVDGKPQTPPSKPRLRPKPAANPKPSSLPTAKVKKPGKPNEKEVEHSMPMKELSNTQ
ITKFPHKHIVALIDQKVDGSSGNTQYEFPVDGSPSRGQAKSSAVIRAQEVRSKLERQFPS
FVKSLVRSHVASCFWMGLPSLFCKSHLPDKDITMTLEDESGRQYQLKYIACKTGLSAGWR
QFAASHNLLEGDVLVFQLVELTKFK
Download sequence
Identical sequences MDP0000236656 MDP0000236656|PACid:22666211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]