SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000236750|PACid:22623596 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000236750|PACid:22623596
Domain Number 1 Region: 437-535
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.86e-22
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 622-721
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-21
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 27-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-16
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 4 Region: 168-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000196
Family B3 DNA binding domain 0.0054
Further Details:      
 
Domain Number 5 Region: 780-876
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000129
Family B3 DNA binding domain 0.0066
Further Details:      
 
Domain Number 6 Region: 954-1004
Classification Level Classification E-value
Superfamily F-box domain 0.00000000011
Family F-box domain 0.0048
Further Details:      
 
Domain Number 7 Region: 339-397
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000255
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000236750|PACid:22623596
Sequence length 1007
Sequence
MPMSSPNHNVPSLIYVTCSLDIVDNYRYMVILLRASYPLQRLPESAVVVYGDYLGDNVVL
KVPNGEKWPIGLTSRDGKVWLNKGWSKFAEFYSLDHGNLLIFSFEGDHSHFHVRIFSRSC
LEKDFGSFFNVEDNLSGETDNVGSSESPLMGSCSKRNGKGPAFPLNAPPSFFKVVLDDTL
RDGXIKIPPIGSMKYEDFIGDKMFLEVPNGLVWPVELSRRDCEIWLRRGWLKFARFYFLE
LGCLLLFTYKGVYSHFQVRIFRRNTLEMDYFNLSDEDETDSNSSGEIECQRMKHDKERRT
HGGDGGMSAAHRSPKVLSRTAQSELEDKTERAFAKARSFKSRNPFVVIRMRPSYISTHLK
LPIYFAQEHICESGERKVTLKISDMRSWSVKCIIQNHSAMCPAAAITLLFVEFSATLELP
AMASLLPETDRARPTFSATTPHFFKIIPNEASRYTKLRIPEKFVNKYGENISNPILLKLP
SGVEWEIQVRTCNGDIWFDKGWPEFSEFYSLDYGDSLVFRYEGNSKFHVCIFDRSATEIE
YPLPFPEVEESDEDDDESFKVLEDFPPCPRTRQKSPLPCPLPRMKKRISTSSSKKFGNKS
SSRRHPLTKNEKSIALQRCIDFKSEKPHFKVVMQPSYIFHNLILPSEFAKRHLMQQPTGS
AILCVPDGGTWRVKFTYANQISRFLCGWLAFVGDNDLRVGDVCVFILIKDIPLSFEVVFY
RGKCKMGKINGRHVSQRPCTSSLSASEVANMSKISNQVTQRPSCLKASRVLEAANKFITK
NPFFRATVRPPSKLMHVPAEFAKRLKLQKKQIAALRVGEQLWPVNIIGYNNEGSRHSHIS
GGWRVFAEENRLREGDVCTFELVEINDIVLKVIQFGLWVFQLPTKSSQNYFKISDCKRSI
GRFGLVGCNRSMKRASLGDDSMAAASSTDVKMKRIKVEEEEEKMVIDCVDQDKLKRAGFS
NLDDNLIFEVFKHVDTRTLGMASCVSKQWHKMAEYERLWELICPGTS
Download sequence
Identical sequences MDP0000236750|PACid:22623596 MDP0000236750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]