SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000237846|PACid:22646691 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000237846|PACid:22646691
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-16
Family B3 DNA binding domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000237846|PACid:22646691
Sequence length 209
Sequence
MNAPQXLASDGDPWLFSDGLIPPHFFXMVADVDXXVVEVKIILDIHMFLASLVXTVAKVE
DPQMGDQRHXPXSNPTIELQGDEFWPLSKKPFFEVIIRKANVKPSYQMVIPAKFQPTLPS
CSIPTVLTFGGKNWEMTYTGGSIQRKFDINWREFVNDNNLKVGDACVFELQECSSTKLAF
RVQILRGDIPSELLGNLKGDIVDAPIIID
Download sequence
Identical sequences MDP0000237846|PACid:22646691 MDP0000237846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]