SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000240942|PACid:22638874 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000240942|PACid:22638874
Domain Number 1 Region: 753-966
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.73e-49
Family Nitrogenase iron protein-like 0.095
Further Details:      
 
Domain Number 2 Region: 107-176
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000294
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000240942|PACid:22638874
Sequence length 1033
Sequence
DLGISSISKTLTHLTASPNKTQHRVSKPKARNACLDIEPRRSSRQRNSVQTYRDDVDIDL
PPLRKRSRSSSSFCGSYLARPMEEVRLCSYEERQAALKAAEKLLENLQTDNPSFVKTMVR
SHVYSCFWLDAVYIGSRTGLSGGWRAFALEHKLDDGDALVFELTEPTRFKIYIVKVSSMS
SIKSIVDKEDIPSAENTSKTAVKRDSESTQKRRTKRGSVSEIDDSQPSPGSESDQRRRSK
RGIVPPTDDAKAATDLESNQIRRSKRGAAPVADDSKTNFNSESNQLRRSKRGAAPVADDS
KMNFNSESNQLRRSRRGTVPVADDSKTNFNSESNQLRRSRRGTVPAMDDTKASPDLGSDQ
KRRSKRGVVPEMDDLEASPKLPTENPKGCETEQEACAMKVDEVAPKQVRKKAKANRVCFT
ESPEGCEVKPEETEEKPEVPEKKPKVEEKNARAKVENECVAKKPRKKXKPEKLLNVDRTP
ACAYGSFTWNAITILVHIHIVYLGSLFLMMFTHHCLNTLVIYREFSVREDVKEVITVLLS
RKXKLQTTRSSEFMGFRDEVSRNATPESDIVVVVIGSGIWPKSKSFKTNVLVLLPKGGKV
ASLAAQELSLAWGFKAELKRLRESLLTIQDFLGAVSGAVSDQPQDRVKAVEEWVMKLKGI
AQDAEDVMDEFDYEVVRRKVELQNHMKKKVLNFFSLSNPLAFRLKMAHKIQKINQSLLYL
KRDASFIGLVSKSKDAIPQESRWDRQTNSLIGRDEITVGREEVVSEIVATLTDSQSNQEN
LAVMPIVGMGGLGKTTLAKSVYNEDSILKFFEKRIWVCVSDTFEVNLILLKMLEQLKPAN
APSSKDNQEALLKFLKDELKDKRYLLVLDDVWNEDPIKWENLMECFSKLHSAGGSKIIVT
TRSSKVASISEKLLQRHELGKLSVDECWSIMKNRAFPNSNAHIAPEFHTVGKEIAKNCGG
VPLVAKPPPRGSPSDVSSPPLLSRSFVDNLVWSQRLINQLSWPLHSSINRCKMLREPSFR
TNETAAGQSGCCG
Download sequence
Identical sequences MDP0000240942 MDP0000240942|PACid:22638874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]