SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000241245|PACid:22642523 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000241245|PACid:22642523
Domain Number 1 Region: 182-276
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-21
Family B3 DNA binding domain 0.0067
Further Details:      
 
Weak hits

Sequence:  MDP0000241245|PACid:22642523
Domain Number - Region: 40-81
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0122
Family B3 DNA binding domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000241245|PACid:22642523
Sequence length 389
Sequence
MLNTHQTKDGSESLTISPFRXEALKRKKKMVMARSNAVRAPTFFKVLVDDFSTQLQIPLA
FLVHFDGKVPQETHLQTPGGTWPGRNGCKKEFVMVIRKRDRPHEEAHGNAVHRKTPRNHG
KQNVDNQGQKGLAYGTGTSXATHANIQIKDEVTDDREYELSMHPRATRTEKAVALQKGND
FEYRNPFFKVPLRFSYTHYGYLALPVMFVKAHLTVRPSDATLRVSDGTTWPVKVGFDVAG
HCRFLSGWRLFVNDNGLEIGDICVFVLINKIXFLFEVVLHRKIGAVSPTLSPGKQSVSNL
LCCEFLLHYVCPLHNTDMSYCFXFSFSGRQTAAEDQFELRNQDRSIIYEASSDENASCKR
RPSISITRPVAYMYILSFVVILPPVNWLV
Download sequence
Identical sequences MDP0000241245|PACid:22642523 MDP0000241245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]