SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000242456|PACid:22650200 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000242456|PACid:22650200
Domain Number 1 Region: 496-582
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-18
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 657-757
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000186
Family B3 DNA binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000242456|PACid:22650200
Sequence length 777
Sequence
MLASSGGLXRSENTEVLLVEAGGGGGGGDGDQEGAKKLPRWWWKXVLDVEEAKKQVMFSL
PMVFTNLFYYLITLVSVMFAGHLGDLELAGATLANSWAIVTGFAFMVGLSGALETLCGQG
FGAKLYKMLGIYLQASCIISFFFCFIISIIWFYTEPILILLYQDPQISKSAAVFMKFLIP
GLFAYGFLQNILRFIQTQFVVLPLLFSLVPVVIHVGIAYGLVHWTALGYKGAPLAASISL
WISVLALAMYVVCSKKFEHTWQGFSLESFHYVVYDLKLALPSALMVCLEEWAFEILVLMG
GLMPNSKETTSLIAMCVNTEAIAYMIMYGLSAAASTRVSNELGAGNPNKAKNAVAVTFKL
SLLLSFAIVLALALGHNTWTHFFSDSHIIADQFASMVPLLTISIVVDSVQGVLSGVARGC
GWQHLTVYVNLATFYLIGMTISSLLGFKFKLXAKGLWIGLICGLSCQAGXLLFLTLRTKW
SVLDLPDLSDVEENEKAVLRIPPKFVKNFNGWSPCKCVLRGPSGLRRTVELEERXNGLFF
NXGWQYFVKDHHLENGDLLVFKYDGESKFKVAIYDTTACEKDVEIADSWRIRSSVPLFNN
GHARVKEEIVELETENYNENCENKVFISGRKKWNHLISGKIPSHDQREATSTQPVLSKSK
NSCFIAIFNNPRRYRATIPRKLAVAEDVLNKKSIMIQDSTGRSWLVKLNVRGKGSQCRVD
MATGLGECXKANQVLPGDEVVFEFVKQSLLQIHIYRVEALGGKSLRLLPRNVRENEP
Download sequence
Identical sequences MDP0000242456|PACid:22650200 MDP0000242456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]