SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000243062|PACid:22657184 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000243062|PACid:22657184
Domain Number 1 Region: 167-237
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.0000000209
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0033
Further Details:      
 
Weak hits

Sequence:  MDP0000243062|PACid:22657184
Domain Number - Region: 261-341
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0615
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.035
Further Details:      
 
Domain Number - Region: 88-162
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0641
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000243062|PACid:22657184
Sequence length 573
Sequence
MSIVDLDLRVFKENTQHHQKFDYHFPFVYVISTVRCNNPFYFPTNQVSPSSTTPPKLQAL
DPVVLSTEASQAVKKRLLDFIRSLSTVLAFAYCLSSAIQQAQKFFMESSDSSNTRNMGFQ
FAGKAVYSAVWVAAVSLFMELLGFSTQRWLTAGGLGTVLLTLAGREIFTNFLSSVMIHAT
RPFVANEWIQTKIEGYDVSGTVEHVGWWSPTIIRGEDREAVHIPNHQFTVNVVRNLSQKT
HWRIKTHLAISHLDVHKINNIVADMRKVLSKNPQVEQQRLHRRVFLDNVTPENQALLILI
SCFVKTSHYEEYLCVKEAIMLDLLRVISHHKARLATPIRTVQKMYSDPDLDSVPFADSMY
NHXGARSRRPFILIEPSYKINGEDKKRSRTQTSGERDGKATMRPSPDSKARETPTSDTKS
DSKAGATSVSDSKTRETPTSDTTAGAKSGETPNSNTKEDPKGAKSSTSNPKNSDRKQQKT
ASGSTTSPVKQEGERTPVPEPPISRPAIEENIVLGVALEGSKRTLPIEEAMASPSAHAEA
NDLAPSHNGTASPIKGKKNDQVPAAPGSTSGND
Download sequence
Identical sequences MDP0000243062 MDP0000243062|PACid:22657184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]