SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000247623|PACid:22644692 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000247623|PACid:22644692
Domain Number 1 Region: 16-121
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-29
Family B3 DNA binding domain 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000247623|PACid:22644692
Sequence length 165
Sequence
MKCYHDFMDTCSRERELLFEKVATPSDVGRLNRMVIPKRYAEKHFQVHQSVGFGKGVLLK
FEDEVGKLWRFGYCYWSSSQSYVLSKGWIRFVKEKKLKVGDVVRFERSVGEDKKLFIDCR
SRNLDISGIGEIHGTVGDPPATVQDDGVVRLFGVNISRKPVHCRE
Download sequence
Identical sequences MDP0000247623|PACid:22644692 MDP0000247623 XP_008357930.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]