SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000250932|PACid:22662666 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000250932|PACid:22662666
Domain Number 1 Region: 79-171,206-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.79e-34
Family GidA-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000250932|PACid:22662666
Sequence length 519
Sequence
MATTPALTLHLSRLARHFPFSSSSLPTPPLFPRARLILRPRDLPFRRTCSFSICNFSRRF
SVSASTTPGLSDDGLHDERYDVIVVGGGHAGCEAAIASAHLGAKTLLLTLNIDRIAWQPC
NPAVGGPAKSQLVHEVDALGGEIGKISDRCYLQKRVLNASRGPAVRALRAQTDKXEYAME
MRKIVERQVNYKNGLRTXXQVSFSSLNXPNLSIREAMVTDILLGKNDNIEGVQTFFGMNF
YAPSVILTTGTFMSGKIWVGRTSMPAGRAGESASLGLTENLQRLGFETDXLKTGTPARVD
RRTVDFSGLEPQHGDEEVGWFSFDLDVHIEREQMCCYLTRTTKSTHQLIKDNLHETPTYG
GWVEAKGPRYCPSIEDKKKRAQSLYVRDLHPREEKYAAFYFNWKSGXNLQDSISLSHTLA
RTATLKEKVRNKEIVRFQDKESHQIFLEPEGRDVPELYVQGFSTGLPERLQLPLLRTLPG
LENCSMLRPAYAVEYDFLPAHQCXRSLMTKKIDGLFFSX
Download sequence
Identical sequences MDP0000250932 MDP0000250932|PACid:22662666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]