SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000250988|PACid:22631677 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000250988|PACid:22631677
Domain Number 1 Region: 140-323
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.55e-26
Family RecA protein-like (ATPase-domain) 0.075
Further Details:      
 
Weak hits

Sequence:  MDP0000250988|PACid:22631677
Domain Number - Region: 68-100
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0732
Family Helical scaffold and wing domains of SecA 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000250988|PACid:22631677
Sequence length 326
Sequence
MEIIIAIASKVGECLVTPIGTEFGYLINYHSNLENLKGEIKKLFDKKDGVQGLVDAAQRN
SERIKPDVQSWLNNVNDDMVKKVLQFEDEINKKRRCVYRWSLSRRAYKIKQEVLQLQNEG
RFENVAYPAPPPEIWSTFENVFKDFKSRRAKMNEVIEGFKREEVRKIGICGMGGVGKTTM
VKEIIIRLAKLNLFDKIVMATVSQSPSIRTIQLEIAEEIGCEVNKLLQSRFLTPEESQEL
FREMVGESFNDPDLRSTAKDVLKECGGFTIAIVTVGKALEKKNKXEWDDALNQLRNSNPV
NIPGVDSKVYSSIKLSYDGLESDEAX
Download sequence
Identical sequences MDP0000250988 MDP0000250988|PACid:22631677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]