SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000251244|PACid:22665628 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000251244|PACid:22665628
Domain Number 1 Region: 1-261,289-317
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.36e-64
Family Tyrosine-dependent oxidoreductases 0.0016
Further Details:      
 
Domain Number 2 Region: 506-577
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000251244|PACid:22665628
Sequence length 581
Sequence
MKILVTGASGYLGGRLCHALLKQGHSVRALVRPTSDLSSLPPPSSTGTASLELVYGDVTD
YESLLSAFSNCDVVFHAAAVVEPWLPDPSKFFSVNVGGLKNVLRAVRETKTVQKIIYTSS
FFALGSTDGGVADETQSKAAADKIALRAAQQEELPLVLLYPGVIYGPGKLTAGNVVARLI
VERFNGRLPGYIGSGNDRYSFSHVDDVVEGHIRAMAKGRTGERYLLTGENASFKHVFDVA
AVITQTGRPKFGIPLWLIEVYGWASVLFSRVTGKLPLISPPTVYVLRHQWAYSCEKAKAE
LGYSPRGLKEGLGEQLQPSLDINCPIINDIVDSQDVLPQHVSISTTAYVPANTNRGANTG
RKAVDFPRLQNPIVQFSERGASLNPNRIVFHMKRAKARTVEKQLVEVRXSSRVANLPTPV
YKEVAVVDREMRPRRYSTNRHRDLSNRVYASDEARDDATARAEAFESDLGSDYPTMVKPM
LQSHVTGGILAGILALILFNACKLQQGLPKYFCSKNLPKRDDIVILIDEDGNECEVIYLA
EKRGLSGGWRGFAIDHDLVDGDALVFQLIRPKTLKVRLQVS
Download sequence
Identical sequences MDP0000251244 MDP0000251244|PACid:22665628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]