SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000251344|PACid:22682514 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000251344|PACid:22682514
Domain Number 1 Region: 49-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.29e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000101
Further Details:      
 
Domain Number 2 Region: 424-534,585-615
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.25e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000251344|PACid:22682514
Sequence length 683
Sequence
MGFRPNPKKMLSLMRRSRSAVGLAAAASFASSRSSSSASTSAAPKLASPTDDLKTLRTKV
CIIGSGPAAHTAAIYAARAELKPILFEGMMANDIAPGGQLTTTTDVENFPGFPDGILGFE
LMDRCRKQSIRFGTAVFTETVNKVDFSTTPFKIFANERTVLADSVVVATGAVAKRLQFPG
SEEYWNRGISACAVCDGAAPIFRNKPLAVIGGGDSAMEEANFLTKFGSEVHIIHRRDTFR
ASKIMQHRALNNPKIQVVWNSVVVEAYGEGKGPLAGLKVKNVVTGEVSDLKVSGLFFAIG
HEPASKFLDGQLELHDDGYVATKPGTTQTSVKGVFAAGDVQDKKYRQAITAAGSADFRFA
VGKDYGKISLLFGSXISYLCIXLSIFMLDDAWQPWKQNTTCKRLDPRRKKAQKLVSAMDD
RKTLRTRICIIGGGLTAHTAAIYAARADLKPILFESCMSNKIXPGGRLTTTTHFENFPVF
PQTILMANYRMQSDRFHATILSEMVNKVDFSATPFKISTEEKTVLADSVVVATGTVARRL
HFTGTAGLIRPALHCVQRHPLSGQAASGDRRLVTGVVWDLKVSGPLSAVGHDPATEFLGG
QLKLDVDGWVCCDEAGDNGDHFERSFCGGRCSEQEVPAGYHCCRNRAMEKGLTNSMPGTS
VFTTRRWPFQTQVSSVSYVNGKL
Download sequence
Identical sequences MDP0000251344|PACid:22682514 MDP0000251344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]