SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000251581|PACid:22621152 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000251581|PACid:22621152
Domain Number 1 Region: 40-301,400-455
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.35e-77
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000353
Further Details:      
 
Domain Number 2 Region: 278-396
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.5e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000795
Further Details:      
 
Domain Number 3 Region: 481-588
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 5.1e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000251581|PACid:22621152
Sequence length 589
Sequence
MWRCVSRGLGVSSSKRSASTDSLRSHFSRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMDSEGGCQGVIALNMEDGTLHRFQASST
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDVT
IPGLMAAGEAACASVHGANRLGANSLLDIVVFGRAWEKQKPLEKDAGEKTIAWLDKIRNS
NGSLPTSKIRLNMQRIMQNNAAVFRTQETLEEGVQLIDKAWESFHDVQLKDRSLIWNSDL
IETIELENLLINASITMHSAEARKESRGAHAREDFTTRDDEKWMKHTLG
Download sequence
Identical sequences MDP0000251581 MDP0000251581|PACid:22621152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]