SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000252244|PACid:22643267 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000252244|PACid:22643267
Domain Number 1 Region: 139-308,404-517
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.64e-36
Family FAD-linked reductases, N-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000252244|PACid:22643267
Sequence length 550
Sequence
MRFRAVYTVAVKLCNIYCTEKSAQRALYTVPVITSLHSPNPTATSPTXIPNRIPQIHKNK
KVNXTLATLTLLSTSSAXAAPTKKMTSIALKSFIGLRQTAXEKTHFTMQAKPISPNXSNR
RTXQVKAAKTSPKVTGRNLRVAVIGGGPAGGAAAETLAKGGVETFLIERKMDNCKPCGGA
IPLCMVGEFDLPLDIIDRRVTKMKMISPSNVAVDIGQTLKPHEYIGMVRREVLDQYLRNR
ASENGATVINGLFLKMDKPGDGEAPYVLHYTEYDGKAGGAGVKKTMEVDAVIGADGANSR
VAKSIDAGDYEYAIAFQERIKIPDDKMVYYENLAEMYVGDDVSPDFYGWVFPKCDHVAVG
TGTVTHKGDIKKFQLATRNRAKDKILGGKILRVEAHPIPEHPRPRRLAGRVALVGDAAGY
VTKCSGEGIYFAAKSGRMCAEAIVEGSENGKRMVNEADLRTYLEKWDKTYWPTYKVLDVL
QKVFYRSNPAREAFVEMCADEYVQKMTFDSYLYKRVVPGNPWEDLKLAVNTIGSLVRANA
LRREMEKITV
Download sequence
Identical sequences MDP0000252244 MDP0000252244|PACid:22643267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]