SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000252726|PACid:22647790 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000252726|PACid:22647790
Domain Number 1 Region: 506-601
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-17
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 698-799
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000116
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000252726|PACid:22647790
Sequence length 820
Sequence
MDXGDMVANTNNTTPLLEGGGHGGAKGGWWNKVLDVEEAKNQVLFSLPMILTNVCYYMIP
LISVMFAGHLGELQLAGATLANSWATVTGFAFMVGLSGALETLCGQGFGAKLYRMLGIYL
QASSIISFLASIIVSVVWFYTEPILILIHQDPQISKYAALYMKFLIPGLFAYGFLHNILR
FLQTQSVVIPLVYFSVIPVVLHVGIAYGLVHWTGLGYVGAPVAASISIWISMLXLATYVL
CAKKFEHTWEGFTLESFHYVLPNLKLALPSAAMVCLEYWAFEILVFMAGVMPKAEQNTSL
IAICTRVSNELGAGNPEKAKNAMAVTLKLSILLALIVDLALAFGHNLWAGAFSDSSVIIK
LFASMTPLLLISILADSVQGVLSGVARGCGWQHLAVYVNLGTFYLVGMTIAGVLAFKLKL
YAKGLWIGLICGLSCQTVLLLVVTLRTKWTQLDLPRNADAVLRKIVSGCWRRCMHVSINW
LFWQSISHSRAHPLITDSLGPMLTLIVKRLSTGCRQIGRXRIPPTFVRKNFNRRSLSKCD
LKGPTGIRRTVEFEDRENGIFFRNGWQGFVKDHHLEAGDLLVFDYDGETKFNVKIYDRSA
CEKDXEAAKMNXVNQARVKDENVDVATGNYNKERKIRTTSRSSKLSSVLVLCIWRRFVSD
ILPCFHSLIRVSDSVGKYLISRKRRYYVEDTSTGSVLLKSENQCFLAFSNKKHLLQCVRI
PKQLAVAEGLMYKNTVTXQDPXGRSWLIQLRIRRXSSTDHLDIXTGWTDCVKANRISPGD
TMIFXFVKQGLMRVHIFKKGAVRGNKCRVVLADPNVKAES
Download sequence
Identical sequences MDP0000252726 MDP0000252726|PACid:22647790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]