SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000253740|PACid:22672932 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000253740|PACid:22672932
Domain Number - Region: 41-68
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0432
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000253740|PACid:22672932
Sequence length 223
Sequence
MEEADEDDDESVEILEDFHRAQKQGRNLHCHLLCLTKKRDKHFFKDNNXKIGNACVFMLI
KGIIITFEVALYYSTEAAICSISSASREPFKISERSRAYNSGTSLDEIDYEDEEKGSVEI
SDDFQRYTRKTREKSPLPSPQPLKKIRTSSKEDGSDDDSVVFLDKLSPCTKXSKALLASS
TASGKAIALVRAIAFGSKSVNLXFWIVMQPVAKPKILEGRGEI
Download sequence
Identical sequences MDP0000253740 MDP0000253740|PACid:22672932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]