SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000254144|PACid:22644986 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000254144|PACid:22644986
Domain Number 1 Region: 160-450,554-596
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.55e-75
Family FAD-linked reductases, N-terminal domain 0.0000295
Further Details:      
 
Domain Number 2 Region: 431-543
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.51e-25
Family L-aminoacid/polyamine oxidase 0.00017
Further Details:      
 
Domain Number 3 Region: 54-154
Classification Level Classification E-value
Superfamily Homeodomain-like 3.49e-20
Family SWIRM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000254144|PACid:22644986
Sequence length 748
Sequence
METPGSDGSVSKRSLRKKASLRNYDENLMDDIIEKHLGGTFKKRKGTKVDLEKETETEAM
IALSLGFPIDELLEEEKQAGVVTELGGKQQNDYIVVRNHILVRWRSNVRVWLSKGQIKET
VSGDYEHLISSAYDFLLYNGYINFGVAPAFMANMPEEVTEGSVIIVGAGLAGLAAARQLM
QLGFKVAVLEGRNRPGGRVYTQKMGKDGKFSAVDLGGSVITGIHANPLGVLARQLSIPLH
KVRDKCPLYKPDGTPVNKDIDSNIEIIFNKLLDKVMELRQTMGGFGNDISLGSVLEKLRQ
LYSVARSTDEKQLLDWHLANLEYANAGCLSNLSAAYWDQDDPYEMGGDHCFLAGGNGRLI
RALCERVPIFYGKTVNTIRYGDEGVEVIAGDQVFRGDMVLCTVPLGVLKKGSIRFEPELP
QRKLAAIERLGFGLLNKVAMVFPHVFWGEELDTFGCLNEHSHQRGEFFLFYGYHTVSGGP
VLIALVAGEAAETFECTEPSILLHRVLSVLRGIYTPKGIDVPNPIQTICTRWGGDPLSYG
SYSHVRVQSSGSDYDLLAESVGNRLFFAGEATTRQHPATMHGAFLSGLREASCIYRATRR
SQNYLRKVIQKNVGSSTDMLEDLFEKPDLEFGNFSCVFDPSIEDPKSIGFMRVGVGSSEN
SYKQELTSSSQNALTIPLQLYTFISREQACGLELVTGGDESRLSYLVKVFGLKLMGPSAI
GTVGNSLAVSIGNARRGRGRNRMSAGRQ
Download sequence
Identical sequences MDP0000254144 MDP0000254144|PACid:22644986 XP_017186888.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]