SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000256328|PACid:22629063 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000256328|PACid:22629063
Domain Number 1 Region: 82-216
Classification Level Classification E-value
Superfamily Phospholipase C/P1 nuclease 4.19e-38
Family P1 nuclease 0.0039
Further Details:      
 
Domain Number 2 Region: 388-537
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000179
Family FAD/NAD-linked reductases, N-terminal and central domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000256328|PACid:22629063
Sequence length 547
Sequence
MEKYRCFGGFSLHWFVLLLVFVCIIMVPRAQGWSKEGHMMXCRIAQLXAYGRIRSGIGTD
TGGLAXFTSSTHQIMLAPLTTQPMHVGFTTDEGGNTIALRWYRHKSNLHHVWDWEIIQQA
MKDYYDKDMELLLQDILANITDGIWSDDVTSWKHCDDQRSCINKYATESINIACKWAYKG
VEAGDTLTEDYFLPRLPVVEKRIAQGGVRLAAILNRVFSSSQDTGVDDDTCKEDRERIHI
RGKWFMKVGPTEQNDTTMRFKEYLPLLLRGEVLNLNMAFERISRTARHGFRRSPSGASSR
TTEKDMLCERASTLKYCSVPSLERETRNNNLSYLSSISKVNHNSFWSRGISITPSYQFPS
AERIVEESDSECNDPKYPGLEATRPSEKPRVVVLGTGWAACRFLKGLDTKVYDVVCISPR
NHMVFTPLLASTCVGTLEFRSVAEPVSRIQSALATSPSSYFYMASCAGLDTDKHEVYCKT
ISNGGLSHXPYRFKVAYDKLVIAAGAEPLTFGIKGVKEHAFFLREVNHAQEIRKKLLLNL
MLSEHPX
Download sequence
Identical sequences MDP0000256328|PACid:22629063 MDP0000256328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]