SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000257606|PACid:22645914 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000257606|PACid:22645914
Domain Number 1 Region: 93-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.52e-38
Family G proteins 0.06
Further Details:      
 
Domain Number 2 Region: 313-537
Classification Level Classification E-value
Superfamily L domain-like 4.76e-31
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 3 Region: 775-856
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.44e-16
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 4 Region: 584-689
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000196
Family B3 DNA binding domain 0.0023
Further Details:      
 
Domain Number 5 Region: 936-994
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000549
Family B3 DNA binding domain 0.0054
Further Details:      
 
Weak hits

Sequence:  MDP0000257606|PACid:22645914
Domain Number - Region: 2-45
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00288
Family Toll/Interleukin receptor TIR domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000257606|PACid:22645914
Sequence length 1062
Sequence
MVVPVFYQVDPSDVRKAKRSFEEAFAEHEGHSNTDMEEVRRWRDDVKLIEEIVKDIFQKL
IRTSSSKDDDLVEMDSHMHEMDLLLHPAPQMDDEEFSXCGAVHMQEKFLSRIXNEKVQSL
GTLDRGYRMILKRXQXKKVLIVLDDVDDXFQIETLLGKQHSFGGGSRIIITTRDKLVLSX
ADAIYSPKVLSGXGALELFSQYAFXTKQPKRDYDHLSSRAVRYAQGLPLALKVLGAFLYN
KSXQEWEEVLEKLKKIPQRGIHDVLRTSFDGLDDSEKDIFLDIACFFKGAEKDNATKATE
AVESIILDPSFSKPEVVYLSSEAFVKMTKLRLLKIHCDSGYSCENLKFLPHELRSLIWKH
FPLKSLPSNFIAKNLVELDMQNSLIEHLWEGAKPLENLKIINLTSSPHLKKTPDFTEAKN
LEKVVFRSCTSLLEVHPSISSLENLVLLDFENCGNLKIFPSRIGMKSLRTLTLSGCENLE
KFPEVSDVMQDLSVLYLNSAGIKELPSSISNLTGLLVLNINGCRNLEGFCRDHYPLTMPE
MEETDEDDDSGNSSWDDDEDSDCVEVLDNIIGKAAVAIRRATAFKSDNPSFIVPMKRNIN
GYSVWLPSKLCIHMRRLGKHSGAVILRVLDGRTWSVEMKCEIATRPKLRLQYGWTEFVRG
NNLEVGDVYVLVLIDDTKLVFEVVIFRATGTAHTFSPPDVDGEQTMSQTEETDEDDDSIE
ILDNFPRCSKTKKKSPTAPQPHKKNRTCSVSTAENRIKKFGGSSLTXKIMNRRTLQYLGA
KFTKEHFLKRNYHQVILRVSDGRTWPVKLSKRQKNMVRLQNGWITFVQDSHLEIGDVCVF
ALINNIKGLMDVVIFHTTEAARCNVSQDGEKPMSQTEETDEDDDCVEILDDSPPCLKTKK
NRVGSISTSETHMKKFGGSSWTKELVKRRPDQNLEAKFAXEHLLNRTHDNVILRVSGGRT
WPVKLHQYSKTVLKFQSGWMTFVQDNGLEIGDSFSAVEKXLIAPFHXVSKFSVGCEFLSA
PSVMRYVVFVLNLNLGGTGSXSPWTXEPLIQGNVTSLAHDLE
Download sequence
Identical sequences MDP0000257606|PACid:22645914 MDP0000257606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]