SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000258032|PACid:22620805 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000258032|PACid:22620805
Domain Number 1 Region: 157-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-40
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 721-799
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000456
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000258032|PACid:22620805
Sequence length 843
Sequence
MTSSEVSIRDNCGNQRGESFSSGFSDHNDARNAGEGHNGHSTVSGAGRDAETALYTELWH
SCAGPLVTVPRERERVFYFPQGHIEQVEASTNQVADQQMPVYNLPSKILCRVINVSLKAE
PDTDEVFAQVTLLPESNQDENAVEKEXPPPPPPRFQVHSFCKTLTASDTSTHGGFSVLRR
HADECLPPLDMSRQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVA
GDAFIFLRGENGELRVGVRRAMRQQGSVPSSVISSHSMHLGVLATAWHAIMTGTMFTVYY
KPRTSPAEFIVPFEQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIIGMEDADTKRWR
DSKWRCLKVRWDETSTIPRPERVSPWKIEPALAPPALNPLPMPRTKRPRTNMVPSSPDSS
VLTREVGLSKVNVDPAMPGGFSRVLQGQELPTLRASFAESESDTAEKSVAWPPSMDEEKI
DGVCASRKYGSENWMSSGRHEPTYTDLLSGFGNNVDSSNGICPPFVDQGVVSSNSMRKHS
LDKEGKYNLHSWSMLPSSLSLSLDSNQKGRLGNMSYQAQGNSRYGGFGESSVMNGQRVEH
PHGNWMMPPPPSPFXNLANAREIMPRPQMLLDKHEAVKPKDGNYKLFGIPLITPDPALSH
RNAMNESPRNNQAHTFESDLKSEKSRGSKSTDNPVAVSEPALQTSQQHTRDAQGKSQGGS
TRSCTKVHKQGIALGRSVDLTKFNHYEELIAELDMLFEFGGELRSPKKNWMIVYTDDEGD
MMLVGDDPWQEFCSIVRKIFIYTREEVQKMNPGTLNAHGEDNLSLGAEGVDARVGKSQPL
PYA
Download sequence
Identical sequences MDP0000258032|PACid:22620805 XP_008392710.1.92800 XP_008392711.1.92800 MDP0000258032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]