SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000258417|PACid:22673144 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000258417|PACid:22673144
Domain Number 1 Region: 116-213
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-23
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000258417|PACid:22673144
Sequence length 494
Sequence
MARKVDGKPQTPPSKPRLRPKPAANPKPSSLPTAKVKKPGKPNEKEVEHSMPMKELSNTQ
ITKFPHKHIVALIDQKVDXSSGNTQYEFPVDGSPSRGQAKSSAVIRAQEVRSKLERQFPS
FVKSLVRSHVASCFWMGLPSLFCKSHLPDKDITMTLEDESGRQYQLKYIACKTGLSAGWR
QFAASHNLLEGDVLVFQLVELTKFKVYIIRSNGMAEVDGALGLXNLDNNTKQKDSGKFIN
LSVXFFLVSYKDNAETSTTPCNDSIRKRAHSPQLVVPKKKKIGLQRAEQSENDSEXAGSE
VSEDLKSPAAALQFEDIRSYENFHILVDGLFLDXEFPEDVRKKYYKLCRSQKAFLHENVI
KGMNPNLIIGAISETVNIADSIKACKVTTXRDDFVSWDKYLTAFELLGMNVGFLRDRICR
LANLADDSGAALEAKMYKEARIERSQAGIGIRNIEVKLEEMREACDEFGAAIESLRSKAE
INTLKFQEEVTAPW
Download sequence
Identical sequences MDP0000258417|PACid:22673144 MDP0000258417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]