SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000258621|PACid:22643700 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000258621|PACid:22643700
Domain Number 1 Region: 538-597
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000000036
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0058
Further Details:      
 
Domain Number 2 Region: 607-705
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0000209
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000258621|PACid:22643700
Sequence length 1437
Sequence
MEGGKGVGEKKGTNDVVLQISVGEERTSYNKETRDLNLQLTELQCLRVSGSSSRSVFSKP
KSRFVEPFPQLKSTANSSNVASPSSKIAGTTPRDALRSAPITPRAPLVDGGEEDDDEEVY
KTAKLKVCAKSGKKIKKLALIELVAFVCIVVFFIAGLTVPTLENKMYLGLELWKWCVLVL
VVLCGRLVTEWFINVLVFVIELNFLLKKNVLYFVYGLKRSVQIFIWLGLVLLAWGLLFDN
GVKRSRKTSRILGYVTRGLASCLIGAAIWLVKNLFVKVVASSFQCNRFFDRIQESIFHQY
VLRTLSGPPLMEMAESVGRAPSSGRLSFKNLKGGKKEGNEGAKEEVIDVEKLKKMNQEKI
SAWTLKGLINVVRSSGLSTISNTLESLDDEESEQKGKEITSEWEAKAAAYDIFLNVTKRS
NKYIEEDDLLRFMKKEEVDIVLPLFEGAAETGKIKRKALKNWLVNVYLERKSLAHSLNDT
KTAIEELNRLASGFLLLVIIIVWLLLMGLFTTNMLVLIASQLLMLAFVFGNTAKTVFEAI
IFVFVMHPFDVGDRCVIEGVQLIVEEMNILTTVFLRSDNEKVYYPNSVLASKPISNFYRS
PEMGNSVDFAIDVSTKIETIVALKARIKEYLDSKTQHWRPAHSVVVKDIEDVNKMIMALY
VTHTINFQNYGDKTSRRSDLIFELKKIFEDLGIKYHLPHQEVHLRYVGASAAELPPTWRL
QDEDSAQLEYPPIYMPTNIPVSDSKSNMYFRCDKLQVEGEAHEGWQHQTAHFPWSQSGGR
PLGAVSIQRAHCLPHAQEAHFTTSENGRRKRRGGEERSKGCRLADSVGEEHTSYNNEIRD
LNLELTELQSLRVSDSAAPEIPRMSHTLPQGKPPKIPTEPASLRAPLSRSAFSKPKPVVP
GEQKVTNEIPHLKSTATFPQRGIAKLQNRRHNTERRSEDDDEEVYKTAKLKVLEKSGKKM
KKLALIELIAFVCIVVFLIACLTALKLKKKMYWGLELWKWCVLVLVVLCGRLVTEWFINV
LVFVIEFNLLLKKNVLYFVYGLKRSVQIFIWLGLVLLAWSLLFDRGVKRSRKTCRILGYV
AQGLASCLIGAAIGLVKNLSVKVVASSFQCNRFFDRIQESIFHQYVLRTLSGPPLMEMAE
RVGRIPSSGQLSFKHLKGGKKEGKEGAKEQVIDVEKPKKMNQKKISAWTLKVLVNVVRRS
GLSTISNTLDSLDDEESEQKGKEITSEWEAKVVAYDIFLNVTKRSNKYIEEDDLLRFMKK
EEVDIVLPLFDGVAETGKIKRKALKNLLVNVYLESKSLARSLNDIKTAIEKLNRLASGVL
LLYWLVNPSATSTTVETTVALKARINEYLDSKTQHWLPGHSVVVKDIEDVNRMKMALYVT
HTINFQNYGDKTNRRSDLVLELKKILEDLGIKYHLLPQEVHLRYVRSSTAELPPTWR
Download sequence
Identical sequences MDP0000258621|PACid:22643700 MDP0000258621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]