SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000258854|PACid:22678384 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000258854|PACid:22678384
Domain Number 1 Region: 205-292
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000053
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000258854|PACid:22678384
Sequence length 320
Sequence
MQLKGQIIRSLARLRILTGKANSLQFIYILLSAHMIRDDAGYSGPAKCWTIETSFPTNGT
ASRDFGVCFXVGGGMLISPLLLQVGVAPEVTAATCSFMVFFSSSMSAFQYLLLGMEHADT
ALIFAIVCFVASLLGLVVLQRAIKVYGRASLIVFSVSIVMALSTVLMTTFGALELYLENQ
EEASGERPRRAEQTVDAKRGSAKTRYVLDDKLAKMVDSKEGLPVTVVDWDTCNQRELTFK
HWNSDDFYVLKGGWRPEFVVRRGLKENDEIGLYLDWDWKTSKYIFRFSVLQRASCYSVGA
EKFKYFNSPPTSNLEHVEKL
Download sequence
Identical sequences MDP0000258854 MDP0000258854|PACid:22678384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]