SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000259062|PACid:22632961 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000259062|PACid:22632961
Domain Number 1 Region: 255-360
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-25
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 679-762
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000638
Family PB1 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000259062|PACid:22632961
Sequence length 823
Sequence
MTYKYQLTHARVAXEAYAVMALKHIXSTSDPGAALPECPTPSLSRKSIFLSPSPSWPRPA
SAILSMTKSSKPLAWTTSMRTRSSPSHSSTVVGRHRKHLRGHLTYTTRVRVLEENRDAVR
CXDADEAAQEAADAVTKRRRVSAPLHPRRTPPFRYALLLSDNPPLRLLSNYGGDLYPELW
KACAGPLVDVPXVQERVLYFPQGHMEQLEASTPTNQELNQGIPQFNLPSKILCXVVNVSL
LAEQETDEVYAQITLIPDANDMTQATPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGW
STFVTSKRLSAGDSFVFLRGXNGELRVGVRRLARQQSSMPSSVISSQSMHVGVLATASHA
LATQTLFVVYYKPRTSQFIIGLNKYLEAVNNKFSVGIRFKMRFEGEDAPERRFSGTIVGL
EDISPHWADSKWRSLKVHWDESASIPRPDKVSPWEIEPFVASVPPSLPQPAVVKNKRPRP
PTEIPDAMSSTASAMWNSGLSQSHDKSPPSVSAEGKRSENHVGWQHQQADVISNNSVPRI
QTDVGWLSSQAGGSPHMFQETMEDSKSASAWPVFSGYSTPNSSKLKNDSMFDHVEKEKKT
ETATSCRIFGIDFTSHSTSSPAMEKVPLQPISGSTGTPEGRVSNMLATESDQKSDLSKTS
KEGKPGQLQLSPKETQSKHSCSMSARSRTKVQMQGIAVGRAVDLTTLEGYDQLIDELEEM
FDIKGQIRPGNIWQIVFTDNEGDMMLMGDDPWSEFCDMVKRIFICSSQNMKKISAGCKLP
MSSQEVEGGPCYWLEGSAEIKHAPEYIDIITVGHCGKVSSVPE
Download sequence
Identical sequences MDP0000259062|PACid:22632961 MDP0000259062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]