SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000259849|PACid:22641186 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000259849|PACid:22641186
Domain Number 1 Region: 63-459
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.22e-101
Family Aconitase iron-sulfur domain 0.000039
Further Details:      
 
Weak hits

Sequence:  MDP0000259849|PACid:22641186
Domain Number - Region: 530-631
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000628
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000259849|PACid:22641186
Sequence length 644
Sequence
MACSTVTPPSTSFIGXKKDLNXSAFSSATPLSSQKCKRKSKKICSVMSPQQSERKPATTG
SVKTGXTXTEKIFARASEKTQLSPGENVWVDVDVLMTHDVCGPGSIGIFKKEFGQNAKVW
DREKVVIIPDHYIFTTDERANRNVDILRDFCMEQNIKYFYDIKDLSNFKANPDYKGVCHV
ALAQEGHCRPGEVLLGTDSHTCTAGAFGQFATGIGNTDAGFVLGTGKLLLKVPPTLRFVM
DGEMPDYLLAKDLILQIIGEISVAGGTYKAMEFVGSTVESLSMEERMTLCNMVVEAGGKN
GIVPADSTTFKYLEDKTSVPYEPVYSDAKARFLKEYRFDISKLEPLVAKPHSPDNRALAR
ECKDVKIDRVYIGSCTGGKTEDFMAAARVFLASGKKVKVPTFLVPATQKVWMDVYSLPVP
GSGGKTCSQIFEEAGCDTPASPSCGACLGGPKDTYARLNEPQASMRLNNKQELPRPNGSQ
GRPDISRFPLYGCCISFDWSRHRPKRVFAKTSYYRNLRSLGSWKINKLGVSDLEKXASLL
LPKKWIIDNVRSYLGDKLFERVQSGMGLRARVHDCDTNTMHYVNFTCWGRGLYVLNGQWW
LEFVLRRGFKEKDQIGLYWEEAEGMFMFSLLERANPIGNFILIG
Download sequence
Identical sequences MDP0000259849 MDP0000259849|PACid:22641186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]