SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000260382|PACid:22663192 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000260382|PACid:22663192
Domain Number 1 Region: 60-135
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000255
Family B3 DNA binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000260382|PACid:22663192
Sequence length 180
Sequence
MKPYERDVTEVLFLVSHSKAEIVDMLRKHSYANELEIYKYKLYNGGAVGLDDGWKARGRE
LLFEKVATPXDVGXLNRMVIPKQHAEKHFQVHLRVGFGKGVLLKFEDEEKKLKVGDVVKF
ERSVGEDKKMFIYCRLRNLDMSGIREMHGRVGDPLRTVQDHGAVRLFGVNISWKPVHCRE
Download sequence
Identical sequences MDP0000260382|PACid:22663192 MDP0000260382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]