SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000261201|PACid:22657417 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000261201|PACid:22657417
Domain Number 1 Region: 138-316,397-522
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.64e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000261201|PACid:22657417
Sequence length 550
Sequence
MRFRAVYTVAVKLCNIYCTEKSAPRSLYTVPVITSLHSPNPTATSPTXIPNRIPQIHKNK
KVNXTLATLTLLSTSSAXAAPTKKMTSIALKSFIGLRQTAXEKTHFTMQAKPISPNSSNR
RTLQVKAAKTSPKVTGRNLRVAVIGGGPAGGAAAETLAKGGVETFLIERKMDNCKPCGGA
IPLCMVGEFDLPLDIIDRRVTKMKMISPSNVAVDIGQTLKPHEYIGMVRREVLDQYLRNR
ASENGATVINGLFLKMDKPGDGEAPYVLHYTEYDGKAGGAGVKKTMEVDAVIGADGANSR
VAKSIDAGDYEYAIAFQERIKIPDDKMVYYENLAEMYVGDDVSPDFYGWVFPKCDHVAVG
TGTVTHKGDIKKFQLATRNRAKDKILGGKILRVEAHPIPEHPRPRRLAGRVALVGDAAGY
VTKCSGEGIYFAAKSGRMCAEAIVEGSENGKRMVNEADLRTYLEKWDKTYWPTYKVLDVL
QKVFYRSNPAREAFVEMCADEYVQKMTFDSYLYKRVVPGNPWEDLKLAVNTIGSLVRANA
LRREMEKITV
Download sequence
Identical sequences MDP0000261201|PACid:22657417 MDP0000261201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]