SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000261821|PACid:22664612 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000261821|PACid:22664612
Domain Number 1 Region: 2-329
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.39e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0019
Further Details:      
 
Domain Number 2 Region: 339-432
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000000000000302
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000261821|PACid:22664612
Sequence length 434
Sequence
MAAKNFKYVILGGGVSAGYAAREFAKQGLKPGELAVISKEAVAPYERPALSKAYLXPESP
ARLPGFHVCVGSGGERLLPDWYKEKGIELILSTEIVKADLPGKTLVSGTGESFKYETLVI
ATGSTVIRLSDFGVKGADAKNIFYLREIDDADKLNEAIKAKKNGKAVIVGGGYIGLELGA
XLRINNLDVKMVYPEPWCMPRLFTSDIAAFYEGYYKNKGVQIIKGTVATGFTADSNGEVK
EVHLKDGTXLEADIVVVGVXGRPLTTLFKGQVEEEKGGIKTDAFFKTSVPNVYAVGDVAT
FPLKLYNEIRRVEHVDHARKSAEQAVKAIKASEEGKTVEEYDYLPFFYSRSFDLSWQFYG
DNVGETVLFGDSNPATPKAKFGSYWIKDGKVVGAFLEGGTPEENKAIAKVAKAQPPVASL
DQLATEGLSFASKI
Download sequence
Identical sequences MDP0000261821 MDP0000261821|PACid:22664612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]