SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000263146|PACid:22654671 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000263146|PACid:22654671
Domain Number 1 Region: 411-631
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0071
Further Details:      
 
Domain Number 2 Region: 6-160
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.98e-21
Family Protein kinases, catalytic subunit 0.0065
Further Details:      
 
Domain Number 3 Region: 575-732
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0062
Further Details:      
 
Domain Number 4 Region: 689-820
Classification Level Classification E-value
Superfamily EF-hand 0.000000158
Family Calmodulin-like 0.048
Further Details:      
 
Domain Number 5 Region: 235-329
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000252
Family Protein kinases, catalytic subunit 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000263146|PACid:22654671
Sequence length 1260
Sequence
MAKIFEINQTEAHINRVVGTYGYMSPEYTRYSHFYEKLDVFSFGVLLLEIVSGKKNVAFY
HFEHSPTLAGWAWELWKEGRGMEVIDESVRETCRPDEALRCIHVGFLCVQEAPSDRPTIS
LVILMLQSTETTSLPPSKEPAFSTYKNSSFVPSSQTPTTMDTKPISLFKFSIILLRVFLK
SRISVAADTISENNSLTGDQTIVSSGGIFELGFFKPGQLSNYYIGIWYSKHLQSVLLEII
SGKKNVVFYRFQNSATLAGWAWELWKDGKGKEVIDGSIGETCWPDGAQRCIHVGFLCVQE
EPDDRLTMSSVVHSCRAMKLHLLHFPKKPSFSTHKNLGTVGSSPRTPTNFSHNLVTMSLP
EASRLFHQRSSLSKILVVVTVSGGGLATFHETKPVHTVYADSAQEAETSRKKKVVVLGTG
WAGVSFLKNLRSSSYDVEVVSPKNYFMFTPLLPSVTCGTVEARSIVEPIRKITEKKGLDV
EFREAECYRIDPKNKKVLCRSTQHSNLGLKEAEFSVDYDYLIVAMGAKTNTFNTPGVEQY
AHFLKGIEDAVRIRQTVIDCFERASLPSASEEEKKKLLSFVCVGGGPAGVEFAAELHDFV
KDDLAKLYPSVTGYVKITVIEASDHILNMFDKRITAFAEGKFFRDGIDVKTGSLVVKLTD
KEVSAKDRDTGKISNIPYGMVLWATGIGPRPEIVDFMKQIGQTNRRVLATDEWLRVEGCD
GVYALGDCATVNQRRVVDDIVSIFRKADKDNSGTLSLEEFQEVMEDLMVRYPQLSLHLKS
KHMRNIDELLENSWKNPKDEXDIETFKAALSQADSQMKNLPATAQVAAQQGAYLADCFNR
MEECEKYPEGPLKFRDVGRHRFQPFRLVGLNFLYDLLEGTNTLGCLPHWEENKLQLIFQE
IGSQLARALSGSGTQYMLAAAAASDVRALTFLPNSAPIRRPNHNPPPFSTSVDPPLFSTA
TRFISSSRTSSSPEQEATLNQILSSIQNAATLLESLYENRLFLSPKSFNSVLVAAAAESG
DLSLLSQLLQVAIASSQPLNSACFLTVAKAFAKSDDCAELLRLTKQVMELTAPSMTVINR
ILFAFGECGETEKALLIFSQMKTLAFVPDLYTHNTVLEILGCAGRIDELVGQFGVMKEAG
IVPDVVSYNTVLNNLRKLGKFDVCLFYFKEMGENGVEADLLTYTAVIESLGRSGNVEEAL
RFFDEMKAREIRPSLYVYRSLITNLKKMGKVDLALSLTEEMNSCDSELAGPMDFKRNKRL
Download sequence
Identical sequences MDP0000263146|PACid:22654671 MDP0000263146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]