SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000263654|PACid:22620434 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000263654|PACid:22620434
Domain Number 1 Region: 499-585
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-17
Family B3 DNA binding domain 0.0082
Further Details:      
 
Domain Number 2 Region: 37-140
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000745
Family Haloperoxidase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000263654|PACid:22620434
Sequence length 802
Sequence
MWSGGGASGSCGGDGGGGGIYWGRKEEVSHSKGIVVIFAWVSIHERHLQNHVDLYSSLGW
NSLVCHSHFLHAFYPEKAMSFAFVILNELVESLGAPFLILCSDKDDLAPYHIICNFTHRL
QELGGDVKLVKLNGSPHLGNTLKSINVLLELSETLWAPSYLGQIENHYKYYPIQYRSSVT
HFLEKAALVFSQRIKELEGDNTSMEGMQDEISELICDLRKAAVNSNQSLRRVAVEPSDHF
FLPSSAENQNRIHLLVVSKAFVAQDYDFCYGLAVNATMLARIEANVGGEAKSFRNVYEYL
CIETCHFDLPISRMTTSDKSRLFTCFGLGEAMKNFNLPVATVKLSVCQTPMAMAVMQDCR
HPQNFTLAMNVKEEEEELSDSEYFPEEKEDDEDHGEAESLTVSQFRLRSRPKSLHSPPPL
VGVEQMEQTLETKQNVLSTWRRPTRPTHITKRKVPGHPQKHGDGGCKRKRTIFDSFKDHE
ISFVRNQVQDIQANLGADPVFVKSMIRSNVSSCFCLTLPKQFCQLYLPLHDATLTLEVEG
GEKYRVTFLGERRIVSAGWQKFSTANKLLVGNLLVFRLVRPLKFKKKHLMTPPRDVSQGN
IQKKSSKLGTNPELVANQSEDDNEDFASNLAADITFRGPAADFEDVRMIDNFTILVNGVT
IDTQLSAQVRTIYYDLCCSQGSFLHDNLLKSIDSKLAAEIITETTNIANAIRACKLPPSR
ADYVMQEKTLHAFELLGMDVGFLRARLKQCLSIASKYEVAAESKRYLEGKVEQVCTREKI
RDLDSKLSELKETMENVGISHT
Download sequence
Identical sequences MDP0000263654 MDP0000263654|PACid:22620434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]