SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000266051|PACid:22641431 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000266051|PACid:22641431
Domain Number 1 Region: 474-554
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.9e-16
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 213-306
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000196
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 3 Region: 420-481
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000241
Family FAD/NAD-linked reductases, N-terminal and central domains 0.036
Further Details:      
 
Domain Number 4 Region: 631-694
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000334
Family B3 DNA binding domain 0.0057
Further Details:      
 
Weak hits

Sequence:  MDP0000266051|PACid:22641431
Domain Number - Region: 328-375
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0275
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000266051|PACid:22641431
Sequence length 779
Sequence
MDQGKWEIGTSSSHDPYAGKECSGGLNLETGYEDHDDKSVEILDDLCPRKSRDKSLVMPK
LEETDKHDDDSNDDISRDSDEVQDDPTIPEEEETDYEDDESVEILDDYSPCPRKTREKSP
LPCLHKKMRTCSSSKAAECNTNFPATKTQPYEIKKSFRSKDSYCSKSEVKKVGGLSSSQI
FQKRTPDVLGREHSLTKSEKALALQRANAFKSEYLHFRLPFNHLISIGLPYEFVRTHLNK
QRSSNVILQILDGSTWPVNFKYDVTXRFQNGWSVFARENNXKVGDLCVFELINRNELTFE
VVFFRATEAKKCSSSAGPSDTSLSAFVSSNPFFRVTLGLGSSRVLRIPTSFSKHFIEKKX
QIVTLWVDDXMWHCWKLARLVGGHEGVAPGQLCTRKSREKSLLPCLQPFKNIRTSSTMLG
LEGFKGEAIHSSKYENGTKYGGKIVLVVGPGNSGMEIAYDLSNSGAYTSIVVQSPKVPMK
FVMKYGEELSSPVYLXLPCGSEWEIELRRCNGEVWFEKGWPEFSKFYSLDYAFWLVFGYE
GNSRFHVFIFDRSCTEVDYPIKLPXKEKTDYEDDESVEILDDFPTSRRRKXERYSSLPCP
LPPKKKXKSYXRMHPLTEKDKAIALQRAIAFKSEKPHFKVAMQPSYIFGNLVNTLAQKVR
FKRGWLEFVRDNNLKTGDVCVFILIKGIELAFEVVFYRGTEAANCSLSPGEXDFSTMKEV
GGLSSSQIFXKRTPDVLGREHSLTKSEKALALQRANAFKSEYPSFPVAIQPSYIHSSYL
Download sequence
Identical sequences MDP0000266051 MDP0000266051|PACid:22641431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]