SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000267855|PACid:22645516 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000267855|PACid:22645516
Domain Number 1 Region: 2-214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.3e-24
Family Extended AAA-ATPase domain 0.019
Further Details:      
 
Domain Number 2 Region: 309-536,655-687
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.88e-19
Family Thi4-like 0.045
Further Details:      
 
Weak hits

Sequence:  MDP0000267855|PACid:22645516
Domain Number - Region: 535-633
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000961
Family D-aminoacid oxidase-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000267855|PACid:22645516
Sequence length 703
Sequence
MVLADGGVVCIDEFDKMRSEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSG
RYDDLKTAQDNIDLQTTILSRFDLIFIVKDIRMYSQDKTIASHIIKVHASAGAALGDGRV
VSKEENWLKRYIQYCRTECHPRLSETASRELQSNYVKIRQDMRQLANETGEAAAVPITVR
QLEAIVRLSEALAKMQLRHEATEEHVREAIRLFNAATMDAAKSGIQQQVNLTGEMANEVK
QAETQIRRRVGIGNHISERKLIDELTRMGMNESTVRRALIIMHQRDEVEYKRERRLHRPP
PSLSPSCVRYAVLGAGFAGLSVAWHLLKQSPKDSNIRVDIYDEAGIGGGASGVSGGLLHP
YSPKAKLLWRAADCWSESLNLLSAAEAAVASAAQTSDGPTPIVRRRGILRPALSLKNLVL
LKDNAQSCLASCRIETLDNDAAQNLVPGISPPLDASFYMPEAVNIHPQRYLQALFLACQN
LVKELCASGSGVKELHLHKSSIHKLLDLEGEYQAVIVCLGAKADMLPELCGRLPLRTCRG
VVAHLQLPDDIGKEYPSLGPSILSDAWLAVQGPRSLYMGSTWEWKSRNSSPDVSAEESGE
XLKELLPKARAVYPVLKDWKFAGARAGLRAMPPLTPHGSLPLLGCVDDIIGENRSSNYWL
FGGLGSRGLLYHGWLGKLMAQAVLSCNEELIPHELXSWKKLKQ
Download sequence
Identical sequences MDP0000267855|PACid:22645516 MDP0000267855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]