SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000267885|PACid:22661160 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000267885|PACid:22661160
Domain Number 1 Region: 240-343
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.02e-21
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000267885|PACid:22661160
Sequence length 770
Sequence
XVXKLSFTPXPLLLSLTIQNDDVLNGFGGLKISNSGDQQSTVPQNGALSDTANEGKLLQL
CQVMEANESNLSSQSQRGDINVSPVQSKQEEVTYPKGEVGPGFSSITRPSIGSLTFAKPD
NGRIMIEVKDMNNPSSEPSLSMTLGGPSATPNFAQPFTGGILEGRDKSKMPSSFQQGQKI
RPILPRPLRPPSPVHHVRVARPPSEGRGKSQLLPRYWPRITDQELQKLAGEYPYLNSTIV
PLFEKVLSASDAGRIGRLVLPKACAEAYFPPISQSEGLPIRIQDVKGNEWTFQFRFWPNN
NSRMYVLEGVTPCIQSMQLQAGDTVTFSRIDPGGRLVIGFRKASRSLDMQDPQTSFLPNG
TPGETSCPSVVENLVTGSGQSSIYQTNTGSKDPYLNALSGHLHLAXGDTSLHNCENHSHL
TSEDLLQRPVSNSDKKRARNIGPKSKRLLLHREDVLELRLTWEEAQDLLRPPPSVKPSIV
TIEDHEFEEYDEPPVFGKRSXFIAESECSCSAPEEVSQKELDNLLRPSIDLKKRRIVVNH
NEAQEXEPSGLDALASASAAILGDSVDYSGEQSLGATTRHPRHRPGCTCIVCIQPPSGKG
KHKPTCTCNVCMTVKRRFKTLMMNKRKRKSEREAENAQRDNNDHKDESEMNGTSTEIELH
RNHSSENGGSSEKRIEADVAESSCAGQIDLNCEPKHNYVQVSGLNLLRLADAVARQPVNN
GTRESFLTNKTCEPQAGLGSSLLAQETAETDRLMCNEGSLSSVAALDFGG
Download sequence
Identical sequences MDP0000267885|PACid:22661160 MDP0000267885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]