SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000267910|PACid:22661241 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000267910|PACid:22661241
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000697
Family Internalin LRR domain 0.068
Further Details:      
 
Domain Number 2 Region: 152-204
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000218
Family Gastric lipase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000267910|PACid:22661241
Sequence length 210
Sequence
MPSSINNLTGLNHLKLENCKELKSLPSSICQLKSLVYLSLSGCTKFEVFPSIEENMEGLR
NLVLDGTSIKELSPWIERLTELRNQSDTXPRCGGFGGIGVVRRLAXAAYFEIPRGGIFQG
ENRSLSFTAVVLCAQLIELSGYSCSEHTELARFDLSEMMRCIYSTSTKVFVVGHSQGTIM
SLAALIQPDIAELVDAAALLSNIILGAYHF
Download sequence
Identical sequences MDP0000267910 MDP0000267910|PACid:22661241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]