SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000268306|PACid:22630740 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000268306|PACid:22630740
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-48
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 761-835
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000128
Family PB1 domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000268306|PACid:22630740
Sequence length 893
Sequence
MRLSSAAFSPQSQEGEKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKE
VDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKDGYLPAGLGSPN
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVL
SSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYIKAVCHTCISVGMRFRM
LFETEESSVRRYMGTITGISDLDPARWPNSHWRSVKVGWDESTAGERQPRVSLWEVEPLT
TFPMYPSTFPLRLKRPWPPGLPSFNGMRDNDLGMNSQLMWLQGNNGDRGMQSLSFSGMGI
TPWMQPRLDASMIGLQPDMYQAMAAAALQEMRAVDPSRLLPTSHLQFQQPQSLPNRSAAL
MQPQMVQVSQSQQPFLQGVQEHHRQSQPQVQTQSHLLQQQFQHQNSFSNQQQQQLVDHQQ
IPSAVSSMTQFASASQSQSPSLQVVTSLCQQQSYSDSNGNPATSTILSPLHSLMGSFPQD
ESSHLLNLPRTNQLISSDGWPSKRAAIDPLSSGVTQCILPRAEQLGPPHITMSQNSISLP
PFPGRECSLDQEGGTDPQSHLLFGVNIESSPLIMQSGMSNLRGVGSNCDSTTLHFPSSNY
MSTGGTDFSLNPAVTPSSCIDESRFLQSPENADRGDPLNRNFVKVYKSGSFGRSLDITKF
SSYQELRNELARLFGLEGELDDPVRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWCIKIL
SPQEVQQMGKRGLELLKSVPNQRPPNNICDDYGSRQDSRNLSSGITSVGSLEY
Download sequence
Identical sequences XP_008371645.1.92800 MDP0000268306 MDP0000268306|PACid:22630740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]