SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000268649|PACid:22647350 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000268649|PACid:22647350
Domain Number 1 Region: 125-198
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000687
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000268649|PACid:22647350
Sequence length 313
Sequence
MDQTAAAAAVAGGGLREKTEASGLRAGVGAELGLVIAKGDKDNPDHKSKVHGSERSGSIH
DLVRAVTSFGVLRKKRMTRHRRSSIINFHDLSSFAGAASSNPLHVLPPPSTLPPARVIDP
TRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPTLESKEGMAINMDDIDGLHVWSFKYR
FWPNNNSRMYVLENTGTYLCLLSLISNIXFLXWIINLVIQARKASDQDHVYGDISGMNIA
VNDLYMQESSSFYMPKMEEDTTAGLSFVYDTTTYSNDSLLDFSGGSMMTNYSRNGSLHES
FGSVENLSLDDFY
Download sequence
Identical sequences MDP0000268649|PACid:22647350 MDP0000268649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]