SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000270747|PACid:22620342 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000270747|PACid:22620342
Domain Number 1 Region: 15-149
Classification Level Classification E-value
Superfamily At5g01610-like 2.88e-38
Family At5g01610-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000270747|PACid:22620342
Sequence length 179
Sequence
MSPTPKPQLGLIPILLLSLSVIPSLSLSLSDSPPTVFDILPKFGLPRGLLPASVSNYTLS
DDGRFVVVLPKTCYLQFDYLVYYEKTITGKLTYGAITDLKGIQVQRFLFWLGVGEIRVDL
PPSDNIYFTVGIINKKLDIGQFQNVRPCRDGLSGSCVGSFKRGIQLPSPVEEIEMLITE
Download sequence
Identical sequences XP_008351718.1.92800 MDP0000270747 MDP0000270747|PACid:22620342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]