SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000271785|PACid:22638372 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000271785|PACid:22638372
Domain Number 1 Region: 33-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-16
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 2 Region: 135-233
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000255
Family B3 DNA binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000271785|PACid:22638372
Sequence length 264
Sequence
MASPLLFCHPLVRWRAPIGPLRLYIQRCSVPQPQLSLPAGFSQNLNERNMKKAVIESCQG
SWQVGVARTGDGTLYFEGGWEEFVKYHNLKVGDFLVFKHLGRMVFHVNVYEPLGCEKAFP
PPPPPAAAAAAATSTSSPLFFLKSISETHSLPSKCYVTIPSEFVKAHGLGDRKKMILKVR
FVGGKWPVELGTWQGGRRGAAISLRTAIRTRGWYKFYEDNRLKIGDCCKFVLKEVPDSKS
KPVIMEVDIKRMVLGSSKAVVNFE
Download sequence
Identical sequences MDP0000271785 MDP0000271785|PACid:22638372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]