SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000273016|PACid:22625369 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000273016|PACid:22625369
Domain Number 1 Region: 107-223
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.89e-16
Family N-utilization substance G protein NusG, N-terminal domain 0.0044
Further Details:      
 
Domain Number 2 Region: 280-328
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000351
Family N-utilization substance G protein NusG, C-terminal domain 0.0043
Further Details:      
 
Weak hits

Sequence:  MDP0000273016|PACid:22625369
Domain Number - Region: 210-269
Classification Level Classification E-value
Superfamily Aspartate receptor, ligand-binding domain 0.0523
Family Aspartate receptor, ligand-binding domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000273016|PACid:22625369
Sequence length 342
Sequence
MTQGLLPWSPCHHSLSPTSLFSLPLAFPITKHTQFPHSISATLEPATAGTQHLTARERRQ
LRNERRESKTGTSWKEEVEEKLLEKPTKKFANWKEELNLNNLAHEGPQWWIIKVSRVKGQ
ETAQLIARLLARNYPQIDFKIYAPXIQDRKKLKNGNLVKPRPLFPGCVFIRCVLDKELHD
FIRECDGVAGFVGSKVGNTKRQITRPRSVSEFDMEAIFRQAKEEQQKAEQAFEQEQQEAA
INDADESAGDSISKPKRRPRKTLDPLINGSSKGKSEKLIPGSSVRVXSGTFAEYVGSLKK
LNKRTKKATVGFTLFGKESLVDLDISEIVLETVEKKVVSETM
Download sequence
Identical sequences MDP0000273016 MDP0000273016|PACid:22625369 XP_008370038.1.92800 XP_008370039.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]