SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000274788|PACid:22660795 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000274788|PACid:22660795
Domain Number 1 Region: 331-415
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000157
Family B3 DNA binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000274788|PACid:22660795
Sequence length 929
Sequence
MSSSSSSSKVCYNSECKEVKSEFPRKGWRLRTGEYCELCDRCYVAYEEGRFCETFHTNAA
GWRCCESCGKRVHCGCIVSSHAFTLLDPGGIECMTCARKNYVMTSNPAWPTSMFFHSPLS
ERLKDLSTKNWTQLAGSGPVPWRQAPSLFNSSIPSSELHTRVPHEVDGSTGINKLNASER
IFVSTLEKKKVEEFSERLMKVNLSIGTQQSLENGIGNPGINHEEKSSSCLNISQQSASLK
EEPSTPQFVPYGSPSETNPQLGVTGTNLRPIAPLAKNYNGNGVESSGDNQIRNARPRADA
RGRNQLLPRYWPRFTDQELQHISGDKNSVITPLFEKMLSASDAGRIGRLVLPKKCAEAYF
PPISQPEGLPLKVQDSKGKEWIFQFRFWPNNNSRMYVLEGVTPCIQSMQLLAGDIGNDIT
SLEKFLMNVRSLSVFPVTFSRLEPEGKLVMGFRKASTSLQSDQENEANKTTNGVSVHAEG
SESRSFLSMNQVELADPSSWSNVDKSGYIAKEALEDKSLIPKKRKNSNLGSKSKRLRIEN
EDLIELKVTWEEAQGLLRPPANHVPTVVVIEGFEFEEYEDAPILGKPTIYATGRAGEKIQ
WVQCEDCFKWRKLPINALLPSKWTCSENSWDPERSLCSAAQELTTEQLQDLLPRCNTVAS
KKMKAAKQDPDNIEVLEGLDTLANLAILGEGESLPSSAQATTKHPRHRPGCSCIVCIQPP
SGKGPKHKQTCTCNVCLTVKRRFRTLMMRREKKQSDKEAETTRRKQHKGQLLVVDKQEDD
TLSYCNVGSSSPNQKIEILELSDDDLNMTKSSTSPFKGQIDLNIQPEREDELSPGSDSGG
MMKLLHDATARYLRQQRLSSSGGSEKSSGNGSQRAASEAGGGGGGEPLSNGVNLESSNGV
NLENSNHDSSNDCPATLSIKPSASMTATG
Download sequence
Identical sequences MDP0000274788|PACid:22660795 MDP0000274788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]