SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000277889|PACid:22667869 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000277889|PACid:22667869
Domain Number - Region: 3-30
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0108
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000277889|PACid:22667869
Sequence length 82
Sequence
MNHKKLVAGDSIVFLRAENGDLCVGIRTANRGLDGGGGNEVASGWNNSHSSDDDSRGCVL
PYGRFCVFXREEDNKMRNGGGV
Download sequence
Identical sequences MDP0000277889|PACid:22667869 MDP0000277889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]