SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000281945|PACid:22676920 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000281945|PACid:22676920
Domain Number 1 Region: 109-205
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000000000000177
Family N-terminal domain of adrenodoxin reductase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000281945|PACid:22676920
Sequence length 215
Sequence
MDLGFARMTPXWQRNIWLTKPSAYKEEWPRSKIESVRSSSGSNCAIWAVLDLRPTILLPL
KRHRRTPFPQSSYSPVTVIRNETSSILLDLEVQAGGLFRGLLSQPKPSPDLPVPGRELSG
VHFAIEFLHANTKSLLDSNLEDGNYISAKGEKVVVIGGGDTGTDCIGTFVRHGCTNIINL
ELLPEPPRKKAPGNRWPQWPRVFRVDYGHQEVAQS
Download sequence
Identical sequences MDP0000281945|PACid:22676920 MDP0000281945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]