SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000284363|PACid:22634918 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000284363|PACid:22634918
Domain Number 1 Region: 386-556
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.41e-44
Family Protein kinases, catalytic subunit 0.0007
Further Details:      
 
Domain Number 2 Region: 681-904
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.29e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0078
Further Details:      
 
Domain Number 3 Region: 851-1007
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000891
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 
Domain Number 4 Region: 988-1076
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000917
Family Calmodulin-like 0.037
Further Details:      
 
Weak hits

Sequence:  MDP0000284363|PACid:22634918
Domain Number - Region: 253-301
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000628
Family Hairpin loop containing domain 0.051
Further Details:      
 
Domain Number - Region: 74-115
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0259
Family alpha-D-mannose-specific plant lectins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000284363|PACid:22634918
Sequence length 1207
Sequence
MNTKPNSKFVFSVILLCAFLEYHVYLAAATISENHSLSGNQTIVSPGRIFELGFFKPGGR
IRFNTVTKQTQILTSWKSSEDPAPGLFSLELDPNGSSAFFIMWNRSRQNWTSGSWDAKLR
VFRLVSTGLNKKIYNLSYVTNATEGYFTHSVYDPRRISRFVLLTSGQIQQLTWIENSTQW
NLVWSQPRKQCEVYDLCGAFGSCNEEGPLACNCLKGFEPKVMRDWDLKDYSGGCSRKTDL
HCGNATTASRKPDRFLELPSMSLPKNNYTMEVGSIAECEPFCLRSCSCTAFAYDSSGCSI
WNGELLDLQQPTSSDKQGRTLYLRLAASEFESSQSNKGLNVGVVIAIVSIITGLLVVIFG
YYLRKKTLEKKREHRKRNGEKNDAELPIFGLRAIIAATNNFAEANKLGEGGFGPVYKGIL
GENQEVAIKRLSKKSGQGQQEFMNELKLIAKLQHTNLVRLLGCCLEDEEMILIYEYMPNR
SLDKLLFDASEKGELDWGRRFQIIDGIAQGVLYIHNGYMLPEYARYGHFSEKLDVFSFGV
LLLEIVSGKKNADFYRFEHSSTLAGWPSIFANDRKFNIFIRHGRYGKTEEERSCXATHSL
LLLSDLRTXLXXLDQPLDSGQPQMTILSFFTRASRAFNGHPAASKLLVLCTISSGGLLAY
AESQSNVGSPIVDPNQNEPRKKRVVVLGTGWAGTSFLKYLDASAYDVQVVSPRNYFAFTP
LLPSVTCGTVEARSIVEPXRNIIKKRNGEIKFWEAECVKIDAANKXVSLRANFDXNLVGN
KEFSLEYDYLVIALGAQVNTFNTPGVKENCHFLKASPEVEDAQKIRMSVIDCFEMAVLPG
LSEEERRRNLHFVIVGGGPTGVEFAAELHDYFQEDLVKLYPMVKDLVKITVIQSGDHILN
MFDDRISTFAEKKFTRDGIDVQTGCRVVSVSDKEITMKVKSKGEVCSIPHGLVVWSTGXG
TRPVVRDFMQQIGQADKRVLVTDEWLRVKGCEDEDIFTIFKAADKDNSGTLTVDEFRDVV
DDIIIRYPQVELYLKSXHLQDVTDLWKDLDGSDKKEVTVEEFKLALSQVDSQMKSLPATA
QVAAQQGTYLSSCFNRREHCKEHPEGPRRFKSSGQHEFLPFRYKHFGQFAPLGGEQAAAE
LPGDWVSMGHSTQWLWYSVYARYSTSAYLFKYVLLYVLLNVRNVERTKYVVLSNPSECAN
VALTAVD
Download sequence
Identical sequences MDP0000284363 MDP0000284363|PACid:22634918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]