SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000288808|PACid:22628543 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000288808|PACid:22628543
Domain Number 1 Region: 106-215
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.55e-30
Family B3 DNA binding domain 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000288808|PACid:22628543
Sequence length 667
Sequence
MDFMQRDQKGYSDKEDQDQEQEDQEEEEDIITTSNSNYGSSPKYKGILLPPPPPHYHQQY
GRQKPWLDVQNHGSPEAINFTDLSLNKDQVSDGGTDQNYWPPNSEREHMFDKVVTPSDVG
KLNRLVIPKQHAERYFPLDSSSNDKGLLLNFQDRTGKPWRFRYSYWNSSQSYVMTKGWSR
FVKEKKLDAGDIVSFERGVGEXGKDRLYIDWRRRPPPPLPPQLHPHNHYGGGRVYSLLQX
PLPSSVMSSMPLRHHEHFLHSNNNVHHPYHHQHHNYQLMNQQYLPHQLHQLQGGGDQHVI
HHQYPMVIDSVPFYQHGNYKNSATSTSNSASASVASSAGKKLRLFGVNMECSSSPIEEDD
HHECQILSSTAIPYQPHLPSSTSSLAFPPLEFIRLPNTTAANQIRHPLQVRLGAXSSLML
KRFIEHLMNDINRICGVLSMXPVKICLAXFHCYNINPSRVTKQDCGAGHEKSGLWLIVFT
AAVTLICSQLLLSFLINFNLDKGHWAAYESKNPKLLGNCKAVADEYIECEPIIILIDLIL
HKTKAYTHLLYNVIDPQAPSFQESLFGKKQGRMGLVHELRLXTLEISKDGLRILAFQFPI
NKKKMFRFQMLMDIVFGNIMFLSTFLLAMRILFSTFPRPLSFAVGFFSKQLQVDRREWTM
VEDSLAE
Download sequence
Identical sequences MDP0000288808|PACid:22628543 MDP0000288808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]